PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g48521.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 215aa    MW: 23708.9 Da    PI: 11.7478
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g48521.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.91.1e-131462148
                      TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                      rg+W++eEd  l   v+++ +  +W t +++ g++R++k+c++rw++yl
  Bradi2g48521.1.p 14 RGPWSPEEDAVLRSFVQRFSNAgNWLTLPHKAGLNRCGKSCRLRWLNYL 62
                      89******************99*************************97 PP

2Myb_DNA-binding30.77e-1069107242
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcks 42 
                       g +T+eEd l++ +  + G++ W+ Ia++++  Rt++++k+
  Bradi2g48521.1.p  69 GGFTKEEDNLILSLYGEIGSK-WSVIAARLP-SRTGNDVKN 107
                       569******************.*********.********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.181966IPR017930Myb domain
SuperFamilySSF466896.42E-2512107IPR009057Homeodomain-like
SMARTSM007171.9E-91364IPR001005SANT/Myb domain
PfamPF002496.0E-121462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-211569IPR009057Homeodomain-like
CDDcd001671.58E-61662No hitNo description
PROSITE profilePS500908.10763108IPR017877Myb-like domain
SMARTSM007177.0E-667115IPR001005SANT/Myb domain
PfamPF002493.2E-969107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-1770108IPR009057Homeodomain-like
CDDcd001671.25E-671108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MGRSPCCDKG SVKRGPWSPE EDAVLRSFVQ RFSNAGNWLT LPHKAGLNRC GKSCRLRWLN  60
YLRPSLRHGG FTKEEDNLIL SLYGEIGSKW SVIAARLPSR TGNDVKNQST GTPSSRRGTC  120
SSQREQQRHL LLPATTASPP PTAPPWLMVN LFLLLRSSIL TQPLQRSTTA ESSRTSRSSC  180
TPSSWGSSSS SSPRPALARL QTGRPCCRNR HHRQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_A3e-18141332115MYB3
3zqc_D3e-18141332115MYB3
3zqc_G3e-18141332115MYB3
3zqc_J3e-18141332115MYB3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2413701e-109AK241370.1 Oryza sativa Japonica Group cDNA, clone: J065154C10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014754128.14e-79PREDICTED: LOW QUALITY PROTEIN: transcription factor RAX2-like
SwissprotQ9SJL71e-55RAX2_ARATH; Transcription factor RAX2
TrEMBLA0A0Q3GEH57e-77A0A0Q3GEH5_BRADI; Uncharacterized protein (Fragment)
STRINGSb03g033160.12e-66(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36890.14e-56MYB family protein